Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS27 Peptide - N-terminal region

RPS27 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MPS-1, MPS1, S27

UniProt

Q5T4L6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPS27 Rabbit Polyclonal Antibody (orb585986) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001021

Preservative

Lyophilized powder

AA Sequence

DLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD68 (Macrophage Marker) (rLAMP4/824), CF640R conjugate, 0.1mg/mL
BNC403434-100 1x 100 µL

CD68 (Macrophage Marker) (rLAMP4/824), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Pleura
CS803228 5x 5 µm

Tissue FFPE Sections, Pleura

Sign In for Pricing
View Details
IGF2R Rabbit Polyclonal Antibody
TA377382 100 µL

IGF2R Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mouse 1700001C19Rik activation kit by CRISPRa
GA210223 1 Kit

Mouse 1700001C19Rik activation kit by CRISPRa

Sign In for Pricing
View Details
C6ORF173 (CENPW) (NM_001012507) Human Over-expression Lysate
LY422874 100 µg

C6ORF173 (CENPW) (NM_001012507) Human Over-expression Lysate

Sign In for Pricing
View Details
Human CCNP activation kit by CRISPRa
GA112742 1 Kit

Human CCNP activation kit by CRISPRa

Sign In for Pricing
View Details