Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPS27 Peptide - N-terminal region

RPS27 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MPS-1, MPS1, S27

UniProt

Q5T4L6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPS27 Rabbit Polyclonal Antibody (orb585986) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001021

Preservative

Lyophilized powder

AA Sequence

DLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

QuantiChrom™ Glutathione S-transferase Assay Kit
DGST-100 100 Tests

QuantiChrom™ Glutathione S-transferase Assay Kit

Sign In for Pricing
View Details
MRPL46 (NM_022163) Human Over-expression Lysate
LY402916 100 µg

MRPL46 (NM_022163) Human Over-expression Lysate

Sign In for Pricing
View Details
Human TRIM72 activation kit by CRISPRa
GA118577 1 Kit

Human TRIM72 activation kit by CRISPRa

Sign In for Pricing
View Details
Lunatic Fringe (LFNG) (Center) Rabbit Polyclonal Antibody
AP52467PU-N 400 µL

Lunatic Fringe (LFNG) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LMO2 (NM_001142315) Human Over-expression Lysate
LY428033 100 µg

LMO2 (NM_001142315) Human Over-expression Lysate

Sign In for Pricing
View Details
Human ZNF83 activation kit by CRISPRa
GA110954 1 Kit

Human ZNF83 activation kit by CRISPRa

Sign In for Pricing
View Details