Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pdia3 Peptide - N-terminal region

Pdia3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

58kDa, ERp57, ERp60, ERp61, Erp, Grp58, PDI, PDI-Q2, PI-PLC, PLC[a], Plca

UniProt

P27773

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Pdia3 Rabbit Polyclonal Antibody (orb585693) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_031978

Preservative

Lyophilized powder

AA Sequence

KVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fsip1 Mouse shRNA Lentiviral Particle (Locus ID 71313)
TL514667V 500 µL Each

Fsip1 Mouse shRNA Lentiviral Particle (Locus ID 71313)

Sign In for Pricing
View Details
Lentiviral human TP53 shRNA (UAS) - Lentiviral human TP53 shRNA (UAS) (25)
GTR15121385 1 Vial

Lentiviral human TP53 shRNA (UAS) - Lentiviral human TP53 shRNA (UAS) (25)

Sign In for Pricing
View Details
ORP150 Rabbit pAb
E47R4248 100 µL

ORP150 Rabbit pAb

Sign In for Pricing
View Details
CDH11 (Cadherin 11, Type 2, OB-Cadherin (Osteoblast), CAD11, CDHOB, OB, OSF-4)
244481 100 µg

CDH11 (Cadherin 11, Type 2, OB-Cadherin (Osteoblast), CAD11, CDHOB, OB, OSF-4)

Sign In for Pricing
View Details
3,4-Dichloro-5-hydroxybenzoic acid
OR1074002-01 25 mg

3,4-Dichloro-5-hydroxybenzoic acid

Sign In for Pricing
View Details
3,4-Dichloro-5-hydroxybenzoic acid
OR1074002-02 50 mg

3,4-Dichloro-5-hydroxybenzoic acid

Sign In for Pricing
View Details