Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCPH1 Peptide - C-terminal region

MCPH1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BRIT1, FLJ12847, MCT

UniProt

Q8NEM0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MCPH1 Rabbit Polyclonal Antibody (orb585792) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078872

Preservative

Lyophilized powder

AA Sequence

VLDDSCDGFKDLIKPHEELKKSGRGKKPTRTLVMTSMPSEKQNVVIQVVD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR6A2 Rabbit Polyclonal Antibody (APC)
orb1002477 100 µL

OR6A2 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
PCMV-AMN-EGFP-3xMyc-Neo Plasmid
PVT70890 2 µg

PCMV-AMN-EGFP-3xMyc-Neo Plasmid

Sign In for Pricing
View Details
Mouse Activin B (ACV-B) ELISA Kit
MBS2802081-01 48 Tests

Mouse Activin B (ACV-B) ELISA Kit

Sign In for Pricing
View Details
Mouse Activin B (ACV-B) ELISA Kit
MBS2802081-02 96 Tests

Mouse Activin B (ACV-B) ELISA Kit

Sign In for Pricing
View Details
Mouse Activin B (ACV-B) ELISA Kit
MBS2802081-03 5x 96 Tests

Mouse Activin B (ACV-B) ELISA Kit

Sign In for Pricing
View Details
Mouse Activin B (ACV-B) ELISA Kit
MBS2802081-04 10x 96 Tests

Mouse Activin B (ACV-B) ELISA Kit

Sign In for Pricing
View Details