Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MCPH1 Peptide - C-terminal region

MCPH1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BRIT1, FLJ12847, MCT

UniProt

Q8NEM0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MCPH1 Rabbit Polyclonal Antibody (orb585792) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_078872

Preservative

Lyophilized powder

AA Sequence

VLDDSCDGFKDLIKPHEELKKSGRGKKPTRTLVMTSMPSEKQNVVIQVVD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DFFB Polyclonal Antibody
RA24185-01 50 µL

DFFB Polyclonal Antibody

Sign In for Pricing
View Details
DFFB Polyclonal Antibody
RA24185-02 100 µL

DFFB Polyclonal Antibody

Sign In for Pricing
View Details
Cyclin H Blocking Peptide
MBS8244364-01 1 mg

Cyclin H Blocking Peptide

Sign In for Pricing
View Details
Cyclin H Blocking Peptide
MBS8244364-02 5 mg

Cyclin H Blocking Peptide

Sign In for Pricing
View Details
Cyclin H Blocking Peptide
MBS8244364-03 5x 5 mg

Cyclin H Blocking Peptide

Sign In for Pricing
View Details
CKAP1 (TBCB) (NM_001281) Human Over-expression Lysate
LS001155 100 µg

CKAP1 (TBCB) (NM_001281) Human Over-expression Lysate

Sign In for Pricing
View Details