Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HCAR2 Peptide - C-terminal region

HCAR2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HM74a, HM74b, NIACR1, PUMAG, Puma-g

UniProt

Q8TDS4

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HCAR2 Rabbit Polyclonal Antibody (orb331249) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_808219

Preservative

Lyophilized powder

AA Sequence

YYFSSPSFPNFFSTLINRCLQRKMTGEPDNNRSTSVELTGDPNKTRGAPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sedaxane
TRC-S242000-25MG 25 mg

Sedaxane

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS648137 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
MIP Polyclonal Antibody
E-AB-17308-01 20 µL

MIP Polyclonal Antibody

Sign In for Pricing
View Details
MIP Polyclonal Antibody
E-AB-17308-02 60 µL

MIP Polyclonal Antibody

Sign In for Pricing
View Details
MIP Polyclonal Antibody
E-AB-17308-03 120 µL

MIP Polyclonal Antibody

Sign In for Pricing
View Details
MIP Polyclonal Antibody
E-AB-17308-04 200 µL

MIP Polyclonal Antibody

Sign In for Pricing
View Details