Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HCAR2 Peptide - C-terminal region

HCAR2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

HM74a, HM74b, NIACR1, PUMAG, Puma-g

UniProt

Q8TDS4

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HCAR2 Rabbit Polyclonal Antibody (orb331249) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_808219

Preservative

Lyophilized powder

AA Sequence

YYFSSPSFPNFFSTLINRCLQRKMTGEPDNNRSTSVELTGDPNKTRGAPE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCR Plates
P9602-N-T 50 Units/Pack

PCR Plates

Sign In for Pricing
View Details
FAM104A (NM_001289412) Human Tagged ORF Clone
RG235978 10 µg

FAM104A (NM_001289412) Human Tagged ORF Clone

Sign In for Pricing
View Details
Human WFDC1 activation kit by CRISPRa
GA111757 1 Kit

Human WFDC1 activation kit by CRISPRa

Sign In for Pricing
View Details
HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3093), CF647 conjugate, 0.1mg/mL
BNC473093-500 1x 500 µL

HER-2 / c-erbB-2 / neu / CD340 (ERBB2/3093), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FAAH2 Polyclonal Antibody
E-AB-15005-01 20 µL

FAAH2 Polyclonal Antibody

Sign In for Pricing
View Details
FAAH2 Polyclonal Antibody
E-AB-15005-02 60 µL

FAAH2 Polyclonal Antibody

Sign In for Pricing
View Details