Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ICOSLG Peptide - C-terminal region

ICOSLG Peptide - C-terminal region

Product Specifications

Product Name Alternative

B7-H2, B7H2, B7RP-1, B7RP1, CD275, GL50, ICOS-L, ICOSL, KIAA0653, LICOS

UniProt

O75144

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ICOSLG Rabbit Polyclonal Antibody (orb585836) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056074

Preservative

Lyophilized powder

AA Sequence

YDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cryopyrin (H-8) Alexa Fluor® 680
sc-518123 AF680 200 µg/mL

Cryopyrin (H-8) Alexa Fluor® 680

Sign In for Pricing
View Details
ITPRIPL1, NT (ITPRIPL1, KIAA1754L, Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1) (MaxLight 490) discontinued
037167-ML490 100 µL

ITPRIPL1, NT (ITPRIPL1, KIAA1754L, Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1) (MaxLight 490) discontinued

Sign In for Pricing
View Details
SOX18 Protein Vector (Human) (pPM-C-HA)
45140021 500 ng

SOX18 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Mouse Monoclonal ACT8 Antibody (mAbGPa) [Alexa Fluor 647]
NBP2-53121AF647 0.1 mL

Mouse Monoclonal ACT8 Antibody (mAbGPa) [Alexa Fluor 647]

Sign In for Pricing
View Details
TGIF (H-1) Alexa Fluor® 680
sc-17800 AF680 200 µg/mL

TGIF (H-1) Alexa Fluor® 680

Sign In for Pricing
View Details
LBR Rabbit Polyclonal Antibody (HRP)
orb2118248 100 µL

LBR Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details