Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ICOSLG Peptide - C-terminal region

ICOSLG Peptide - C-terminal region

Product Specifications

Product Name Alternative

B7-H2, B7H2, B7RP-1, B7RP1, CD275, GL50, ICOS-L, ICOSL, KIAA0653, LICOS

UniProt

O75144

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ICOSLG Rabbit Polyclonal Antibody (orb585836) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_056074

Preservative

Lyophilized powder

AA Sequence

YDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDKITENP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BARHL1 (NM_020064) Human Tagged ORF Clone
RG220559 10 µg

BARHL1 (NM_020064) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rat rno-miR-762 miRNA Antagomir
abx890491-01 10 nmol

Rat rno-miR-762 miRNA Antagomir

Sign In for Pricing
View Details
Rat rno-miR-762 miRNA Antagomir
abx890491-02 20 nmol

Rat rno-miR-762 miRNA Antagomir

Sign In for Pricing
View Details
TMEM53 (NM_024587) Human Tagged ORF Clone Lentiviral Particle
RC209503L3V 200 µL

TMEM53 (NM_024587) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
pUNO1-mIL1R2(mb)
puno1-mil1r2mb 20 µg

pUNO1-mIL1R2(mb)

Sign In for Pricing
View Details
Tsc22d1 3'UTR Lenti-reporter-Luc Vector
48545086 1.0 µg

Tsc22d1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details