Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL1 Peptide - C-terminal region

ARL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ARFL1

UniProt

P40616

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARL1 Rabbit Polyclonal Antibody (orb585845) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001168

Preservative

Lyophilized powder

AA Sequence

ILVVFANKQDMEQAMTSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zfp109 3'UTR Luciferase Stable Cell Line
TU122586 1.0 mL

Zfp109 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
GM2A Antibody, HRP conjugated
A36871-50UG 50 µg

GM2A Antibody, HRP conjugated

Sign In for Pricing
View Details
SARS-CoV-2 Omicron Spike RBD Alkaline Phosphatase
B2010595 25 µg

SARS-CoV-2 Omicron Spike RBD Alkaline Phosphatase

Sign In for Pricing
View Details
Dullard CRISPR Activation Plasmid (h)
sc-418250-ACT 20 µg

Dullard CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Chicken Nuclear Matrix Protein 22 ELISA Kit
MBS7265007-01 48 Well

Chicken Nuclear Matrix Protein 22 ELISA Kit

Sign In for Pricing
View Details
Chicken Nuclear Matrix Protein 22 ELISA Kit
MBS7265007-02 96 Well

Chicken Nuclear Matrix Protein 22 ELISA Kit

Sign In for Pricing
View Details