Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ARL1 Peptide - C-terminal region

ARL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ARFL1

UniProt

P40616

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ARL1 Rabbit Polyclonal Antibody (orb585845) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001168

Preservative

Lyophilized powder

AA Sequence

ILVVFANKQDMEQAMTSSEMANSLGLPALKDRKWQIFKTSATKGTGLDEA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dia 1 (m) -PR
sc-35191-PR 10 µM - 20 µL

Dia 1 (m) -PR

Sign In for Pricing
View Details
TBL1XR1, NT (TBL1XR1, IRA1, TBLR1, F-box-like/WD repeat-containing protein TBL1XR1, Nuclear receptor corepressor/HDAC3 complex subunit TBLR1, TBL1-related protein 1, Transducin beta-like 1X-related protein 1) (PE)
MBS6354116-01 0.2 mL

TBL1XR1, NT (TBL1XR1, IRA1, TBLR1, F-box-like/WD repeat-containing protein TBL1XR1, Nuclear receptor corepressor/HDAC3 complex subunit TBLR1, TBL1-related protein 1, Transducin beta-like 1X-related protein 1) (PE)

Sign In for Pricing
View Details
TBL1XR1, NT (TBL1XR1, IRA1, TBLR1, F-box-like/WD repeat-containing protein TBL1XR1, Nuclear receptor corepressor/HDAC3 complex subunit TBLR1, TBL1-related protein 1, Transducin beta-like 1X-related protein 1) (PE)
MBS6354116-02 5x 0.2 mL

TBL1XR1, NT (TBL1XR1, IRA1, TBLR1, F-box-like/WD repeat-containing protein TBL1XR1, Nuclear receptor corepressor/HDAC3 complex subunit TBLR1, TBL1-related protein 1, Transducin beta-like 1X-related protein 1) (PE)

Sign In for Pricing
View Details
Malotilate
A2486-5 5 mg

Malotilate

Sign In for Pricing
View Details
Phospho-CDC42 (Ser71) Recombinant Antibody, APC Conjugated
bsm-61349R-APC-TR 20 µL

Phospho-CDC42 (Ser71) Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
SIV p55, Recombinant (Simian Immunodeficiency Virus)
209205 2 µg

SIV p55, Recombinant (Simian Immunodeficiency Virus)

Sign In for Pricing
View Details