Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2RY11 Peptide - C-terminal region

P2RY11 Peptide - C-terminal region

Product Specifications

Product Name Alternative

P2Y11

UniProt

Q96G91

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with P2RY11 Rabbit Polyclonal Antibody (orb585853) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002557

Preservative

Lyophilized powder

AA Sequence

VPSLGCCCRHCPGYRDSWNPEDAKSTGQALPLNATAAPKPSEPQSRELSQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rbm4b Mouse Gene Knockout Kit (CRISPR)
KN514578 1 Kit

Rbm4b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Guanosine-5'-triphosphate Trisodium Salt (Technical Grade)
TRC-G837910-25MG 25 mg

Guanosine-5'-triphosphate Trisodium Salt (Technical Grade)

Sign In for Pricing
View Details
Lymphocyte Specific Protein 1 (LSP1) / pp52 (LSP1/3042), CF568 conjugate, 0.1mg/mL
BNC683042-500 1x 500 µL

Lymphocyte Specific Protein 1 (LSP1) / pp52 (LSP1/3042), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pure Salvia horminum -SHA-
L-3401-2 2 mg

Pure Salvia horminum -SHA-

Sign In for Pricing
View Details
Col9a2 Mouse Gene Knockout Kit (CRISPR)
KN503655 1 Kit

Col9a2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Snx5 Mouse Gene Knockout Kit (CRISPR)
KN516446 1 Kit

Snx5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details