Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2RY11 Peptide - C-terminal region

P2RY11 Peptide - C-terminal region

Product Specifications

Product Name Alternative

P2Y11

UniProt

Q96G91

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with P2RY11 Rabbit Polyclonal Antibody (orb585853) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002557

Preservative

Lyophilized powder

AA Sequence

VPSLGCCCRHCPGYRDSWNPEDAKSTGQALPLNATAAPKPSEPQSRELSQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cryptotanshinone
TRC-C827480-50MG 50 mg

Cryptotanshinone

Sign In for Pricing
View Details
SAPK4 (MAPK13) (NM_002754) Human Over-expression Lysate
LC400973 20 µg

SAPK4 (MAPK13) (NM_002754) Human Over-expression Lysate

Sign In for Pricing
View Details
APRT Human Gene Knockout Kit (CRISPR)
KN416874 1 Kit

APRT Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
INPP1 (NM_001128928) Human Over-expression Lysate
LC427029 20 µg

INPP1 (NM_001128928) Human Over-expression Lysate

Sign In for Pricing
View Details
Copper(II) Sulfate
TRC-C725040-5G 5 g

Copper(II) Sulfate

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1388), CF488A conjugate, 0.1mg/mL
BNC881388-500 1x 500 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1388), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details