Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRHR2 Peptide - N-terminal region

CRHR2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CRFR2, CRF2, CRF-RB, HM-CRF

UniProt

Q13324

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CRHR2 Rabbit Polyclonal Antibody (orb585857) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001189404

Preservative

Lyophilized powder

AA Sequence

NTTLDQIGTCWPRSAAGALVERPCPEYFNGVKYNTTRNAYRECLENGTWA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TWEAKR (TNFRSF12A) (NM_016639) Human Over-expression Lysate
LC402582 20 µg

TWEAKR (TNFRSF12A) (NM_016639) Human Over-expression Lysate

Sign In for Pricing
View Details
Human C14orf166B (LRRC74A) activation kit by CRISPRa
GA115523 1 Kit

Human C14orf166B (LRRC74A) activation kit by CRISPRa

Sign In for Pricing
View Details
Human ARHGDIG activation kit by CRISPRa
GA100288 1 Kit

Human ARHGDIG activation kit by CRISPRa

Sign In for Pricing
View Details
CD134 Recombinant Rabbit monoclonal Antibody
HA723183 100 µL

CD134 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Ugt2b35 Mouse Gene Knockout Kit (CRISPR)
KN518676 1 Kit

Ugt2b35 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SNAP43 (SNAPC1) Rabbit Polyclonal Antibody
TA370361 100 µL

SNAP43 (SNAPC1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details