Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUSP4 Peptide - N-terminal region

DUSP4 Peptide - N-terminal region

Product Specifications

Product Name Alternative

HVH2, MKP-2, MKP2, TYP

UniProt

Q13115

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DUSP4 Rabbit Polyclonal Antibody (orb585859) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001385

Preservative

Lyophilized powder

AA Sequence

RAKGSVSLEQILPAEEEVRARLRSGLYSAVIVYDERSPRAESLREDSTVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK2AP1 siRNA (m)
sc-60344 10 µM

CDK2AP1 siRNA (m)

Sign In for Pricing
View Details
TSKS Lentiviral Activation Particles (h2)
sc-412933-LAC-2 200 µL

TSKS Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
PSMA4 Rabbit Polyclonal Antibody
E10G09878 100 µL

PSMA4 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
FGF2 Recombinant Antibody
bsm-34016R-01 20 µL

FGF2 Recombinant Antibody

Sign In for Pricing
View Details
FGF2 Recombinant Antibody
bsm-34016R-02 100 µL

FGF2 Recombinant Antibody

Sign In for Pricing
View Details
Recombinant TWiK family of potassium channels protein 7 (twk-7)
MBS1023446 Inquire

Recombinant TWiK family of potassium channels protein 7 (twk-7)

Sign In for Pricing
View Details