Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCKAR Peptide - N-terminal region

CCKAR Peptide - N-terminal region

Product Specifications

Product Name Alternative

CCK-A, CCK1-R, CCKRA

UniProt

P32238

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCKAR Rabbit Polyclonal Antibody (orb331266) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000721

Preservative

Lyophilized powder

AA Sequence

GLENETLFCLDQPRPSKEWQPAVQILLYSLIFLLSVLGNTLVITVLIRNK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Triheptadecenoin (cis-10), glycerol D5, (D, 99%)
MBS393866-01 50 mg

Triheptadecenoin (cis-10), glycerol D5, (D, 99%)

Sign In for Pricing
View Details
Triheptadecenoin (cis-10), glycerol D5, (D, 99%)
MBS393866-02 5x 50 mg

Triheptadecenoin (cis-10), glycerol D5, (D, 99%)

Sign In for Pricing
View Details
Rabbit Polyclonal Livin Antibody
NB100-56145 0.05 mL

Rabbit Polyclonal Livin Antibody

Sign In for Pricing
View Details
PIC 287-DIA 100-B7525 Electrical & Equipment Safety Signs (No Adhesive)
257979 1 Card (1 Panel (s) x 1 Pack)

PIC 287-DIA 100-B7525 Electrical & Equipment Safety Signs (No Adhesive)

Sign In for Pricing
View Details
Recombinant Mouse CXCL1/KC
453-KC-050 50 µg

Recombinant Mouse CXCL1/KC

Sign In for Pricing
View Details
Anti-Spermine Synthase Rabbit Monoclonal Antibody
MA5224-.05 50 µL

Anti-Spermine Synthase Rabbit Monoclonal Antibody

Sign In for Pricing
View Details