Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CERK Peptide - C-terminal region

CERK Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp434E0211, FLJ21430, FLJ23239, KIAA1646, LK4, MGC131878, dA59H18.2, dA59H18.3, hCERK

UniProt

Q8TCT0

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CERK Rabbit Polyclonal Antibody (orb585869) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_073603

Preservative

Lyophilized powder

AA Sequence

PSCCCTVSNSSWNCDGEVLHSPAIEVRVHCQLVRLFARGIEENPKPDSHS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDLIM1 (NM_020992) Human Over-expression Lysate
LS009124 100 µg

PDLIM1 (NM_020992) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS644807 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details
TBX21 (T-Box 21, T-PET, T-bet, TBET, TBLYM) (MaxLight 650)
MBS6230234-01 0.1 mL

TBX21 (T-Box 21, T-PET, T-bet, TBET, TBLYM) (MaxLight 650)

Sign In for Pricing
View Details
TBX21 (T-Box 21, T-PET, T-bet, TBET, TBLYM) (MaxLight 650)
MBS6230234-02 5x 0.1 mL

TBX21 (T-Box 21, T-PET, T-bet, TBET, TBLYM) (MaxLight 650)

Sign In for Pricing
View Details
Platelet selectin (P-Selectin) Rabbit ELISA Kit
F9479 96 Tests

Platelet selectin (P-Selectin) Rabbit ELISA Kit

Sign In for Pricing
View Details
PGLYRP2 Protein Vector (Human) (pPB-C-His)
PV110706 500 ng

PGLYRP2 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details