Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LGALS7 Peptide - middle region

LGALS7 Peptide - middle region

Product Specifications

Product Name Alternative

GAL7, LGALS7A

UniProt

P47929

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LGALS7 Rabbit Polyclonal Antibody (orb585877) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002298

Preservative

Lyophilized powder

AA Sequence

LDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Acetyl Coenzyme A Carboxylase/ACACB Antibody Picoband®, Carrier-free
A03668-2-carrier-free 100 µg/Vial

Anti-Acetyl Coenzyme A Carboxylase/ACACB Antibody Picoband®, Carrier-free

Sign In for Pricing
View Details
Lentiviral mouse Adam3 shRNA (UAS) - Lentiviral mouse Adam3 shRNA (UAS, iRFP) plasmid
GTR15121108 1 Vial

Lentiviral mouse Adam3 shRNA (UAS) - Lentiviral mouse Adam3 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Rabbit Monoclonal Lipocalin-2/NGAL Antibody (508)
NBP3-23485 100 µL

Rabbit Monoclonal Lipocalin-2/NGAL Antibody (508)

Sign In for Pricing
View Details
Non-sterile CA Syringe Filters, 5.0 (μm), 13 (mm), PP Prefilter, 100pcs/pk
11058608 100 PCS

Non-sterile CA Syringe Filters, 5.0 (μm), 13 (mm), PP Prefilter, 100pcs/pk

Sign In for Pricing
View Details
CESA4 Antibody (FITC)
orb685827-01 50 μL

CESA4 Antibody (FITC)

Sign In for Pricing
View Details
CESA4 Antibody (FITC)
orb685827-02 100 µL

CESA4 Antibody (FITC)

Sign In for Pricing
View Details