Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STC2 Peptide - C-terminal region

STC2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

STC-2, STCRP

UniProt

O76061

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STC2 Rabbit Polyclonal Antibody (orb585883) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003705

Preservative

Lyophilized powder

AA Sequence

HHLPEPSSRETGRGAKGERGSKSHPNAHARGRVGGLGAQGPSGSSEWEDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAZ (WWTR1) (NM_001168278) Human Over-expression Lysate
LY433001 100 µg

TAZ (WWTR1) (NM_001168278) Human Over-expression Lysate

Sign In for Pricing
View Details
SRP9 (NM_003133) Human Over-expression Lysate
LY418876 100 µg

SRP9 (NM_003133) Human Over-expression Lysate

Sign In for Pricing
View Details
Cyclin E (G1/S-Phase Cyclin) (CCNE1/2460), CF568 conjugate, 0.1mg/mL
BNC682460-500 1x 500 µL

Cyclin E (G1/S-Phase Cyclin) (CCNE1/2460), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRMT12 Mouse Monoclonal Antibody [Clone ID: OTI3C10]
CF809502 100 µg

TRMT12 Mouse Monoclonal Antibody [Clone ID: OTI3C10]

Sign In for Pricing
View Details
beta Catenin (CTNNB1) (NM_001098210) Human Recombinant Protein
TP314557M 100 µg

beta Catenin (CTNNB1) (NM_001098210) Human Recombinant Protein

Sign In for Pricing
View Details
S100 alpha 6 (S100A6) Rabbit Polyclonal Antibody
TA361206 100 µL

S100 alpha 6 (S100A6) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details