Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STC2 Peptide - C-terminal region

STC2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

STC-2, STCRP

UniProt

O76061

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STC2 Rabbit Polyclonal Antibody (orb585883) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003705

Preservative

Lyophilized powder

AA Sequence

HHLPEPSSRETGRGAKGERGSKSHPNAHARGRVGGLGAQGPSGSSEWEDE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Breast
CR560107 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
BAX (BH3 Domain) Rabbit Polyclonal Antibody
AP11294PU-N 400 µL

BAX (BH3 Domain) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
T Cell Leukemia/Lymphoma Protein 1A Antibody
KC-1246-01 50 μL

T Cell Leukemia/Lymphoma Protein 1A Antibody

Sign In for Pricing
View Details
T Cell Leukemia/Lymphoma Protein 1A Antibody
KC-1246-02 100 µL

T Cell Leukemia/Lymphoma Protein 1A Antibody

Sign In for Pricing
View Details
T Cell Leukemia/Lymphoma Protein 1A Antibody
KC-1246-03 1 mL

T Cell Leukemia/Lymphoma Protein 1A Antibody

Sign In for Pricing
View Details
PPOX Polyclonal Antibody
E-AB-16730-01 20 µL

PPOX Polyclonal Antibody

Sign In for Pricing
View Details