Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RENBP Peptide - C-terminal region

RENBP Peptide - C-terminal region

Product Specifications

Product Name Alternative

RBP, RNBP

UniProt

P51606

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RENBP Rabbit Polyclonal Antibody (orb585888) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002901

Preservative

Lyophilized powder

AA Sequence

PHSEAMIAFLMGYSDSGDPVLLRLFYQVAEYTFRQFRDPEYGEWFGYLSR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ephrin-B3 (D-11) Alexa Fluor® 647
sc-390696 AF647 200 µg/mL

Ephrin-B3 (D-11) Alexa Fluor® 647

Sign In for Pricing
View Details
EOMA Cell Complete Medium
CM-1225 4x 125 mL

EOMA Cell Complete Medium

Sign In for Pricing
View Details
OSGIN1 antibody
70R-19063 50 ul

OSGIN1 antibody

Sign In for Pricing
View Details
IRF-9 Rabbit mAb
RDSA65732 100 µL

IRF-9 Rabbit mAb

Sign In for Pricing
View Details
Rifampicin for Lab use 97-102%
214845-01 1 g

Rifampicin for Lab use 97-102%

Sign In for Pricing
View Details
Rifampicin for Lab use 97-102%
214845-02 5 g

Rifampicin for Lab use 97-102%

Sign In for Pricing
View Details