Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RENBP Peptide - C-terminal region

RENBP Peptide - C-terminal region

Product Specifications

Product Name Alternative

RBP, RNBP

UniProt

P51606

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RENBP Rabbit Polyclonal Antibody (orb585888) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002901

Preservative

Lyophilized powder

AA Sequence

PHSEAMIAFLMGYSDSGDPVLLRLFYQVAEYTFRQFRDPEYGEWFGYLSR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Chemerin (CHEM)
MBS2012391-01 0.01 mg

Recombinant Chemerin (CHEM)

Sign In for Pricing
View Details
Recombinant Chemerin (CHEM)
MBS2012391-02 0.05 mg

Recombinant Chemerin (CHEM)

Sign In for Pricing
View Details
Recombinant Chemerin (CHEM)
MBS2012391-03 0.1 mg

Recombinant Chemerin (CHEM)

Sign In for Pricing
View Details
Recombinant Chemerin (CHEM)
MBS2012391-04 0.2 mg

Recombinant Chemerin (CHEM)

Sign In for Pricing
View Details
Recombinant Chemerin (CHEM)
MBS2012391-05 0.5 mg

Recombinant Chemerin (CHEM)

Sign In for Pricing
View Details
Recombinant Chemerin (CHEM)
MBS2012391-06 1 mg

Recombinant Chemerin (CHEM)

Sign In for Pricing
View Details