Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RENBP Peptide - N-terminal region

RENBP Peptide - N-terminal region

Product Specifications

Product Name Alternative

RBP, RNBP

UniProt

P51606

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_002901

Preservative

Lyophilized powder

AA Sequence

KGLPARQDMEKERETLQAWKERVGQELDRVVAFWMEHSHDQEHGGFFTCL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ano4 3'UTR Luciferase Stable Cell Line
TU200682 1.0 mL

Ano4 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Analogue Vortex Mixer
MIX6700 1 Each

Analogue Vortex Mixer

Sign In for Pricing
View Details
Krtap6 (Krtap6-1) (NM_010672) Mouse Tagged Lenti ORF Clone
MR215220L4 10 µg

Krtap6 (Krtap6-1) (NM_010672) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
COLEC11 (NM_199235) Human Recombinant Protein
TP303199L 1 mg

COLEC11 (NM_199235) Human Recombinant Protein

Sign In for Pricing
View Details
Human urease related protein C (UreC) ELISA Kit
NSL1578Hu 96 Tests

Human urease related protein C (UreC) ELISA Kit

Sign In for Pricing
View Details
YARS2 siRNA (Human)
orb1858768-01 15 nmol

YARS2 siRNA (Human)

Sign In for Pricing
View Details