Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCTP Peptide - middle region

PCTP Peptide - middle region

Product Specifications

Product Name Alternative

STARD2

UniProt

Q9UKL6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PCTP Rabbit Polyclonal Antibody (orb585910) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001095872

Preservative

Lyophilized powder

AA Sequence

QLGERSGVIRVKQYKQSLAIESDGKKGSKVFMYYFDNPGGQIPSWLINWA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDK4 Antibody
KC-353-01 50 μL

CDK4 Antibody

Sign In for Pricing
View Details
CDK4 Antibody
KC-353-02 100 µL

CDK4 Antibody

Sign In for Pricing
View Details
CDK4 Antibody
KC-353-03 1 mL

CDK4 Antibody

Sign In for Pricing
View Details
6-Nitro-1-pyrenol-d8
TRC-N519987-1MG 1 mg

6-Nitro-1-pyrenol-d8

Sign In for Pricing
View Details
TEX22 (NM_001195082) Human Over-expression Lysate
LC433992 20 µg

TEX22 (NM_001195082) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Glucose Transporter GLUT2 Antibody
RC-15263-01 50 μL

Recombinant Glucose Transporter GLUT2 Antibody

Sign In for Pricing
View Details