Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCTP Peptide - middle region

PCTP Peptide - middle region

Product Specifications

Product Name Alternative

STARD2

UniProt

Q9UKL6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PCTP Rabbit Polyclonal Antibody (orb585910) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001095872

Preservative

Lyophilized powder

AA Sequence

QLGERSGVIRVKQYKQSLAIESDGKKGSKVFMYYFDNPGGQIPSWLINWA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ropn1 Mouse Gene Knockout Kit (CRISPR)
KN514982 1 Kit

Ropn1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS636357 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
CFHR3 antibody
FNab09927 100 µg

CFHR3 antibody

Sign In for Pricing
View Details
Human LKAAEAR1 activation kit by CRISPRa
GA116305 1 Kit

Human LKAAEAR1 activation kit by CRISPRa

Sign In for Pricing
View Details
Erdr1 (NM_133362) Mouse Tagged ORF Clone
MG201549 10 µg

Erdr1 (NM_133362) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
AMACR / p504S (Prostate Cancer Marker) (AMACR/2748R), CF680R conjugate, 0.1mg/mL
BNC812748-100 1x 100 µL

AMACR / p504S (Prostate Cancer Marker) (AMACR/2748R), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details