Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ORC5 Peptide - C-terminal region

ORC5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ORC5, ORC5P, ORC5T

UniProt

O43913

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ORC5 Rabbit Polyclonal Antibody (orb326491) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_859531

Preservative

Lyophilized powder

AA Sequence

TRKLWRNIEPHLKKAMQTVYLREISSSQWEKLQKDDTDPGQLKGIRGSIE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human UGT1A3 activation kit by CRISPRa
GA110210 1 Kit

Human UGT1A3 activation kit by CRISPRa

Sign In for Pricing
View Details
MARK3 Mouse Monoclonal Antibody [Clone ID: OTI2D3]
CF805765 100 µg

MARK3 Mouse Monoclonal Antibody [Clone ID: OTI2D3]

Sign In for Pricing
View Details
Frozen Tissue Sections, Parotid gland
CS500821 5x 5 µm

Frozen Tissue Sections, Parotid gland

Sign In for Pricing
View Details
TF2-HQKLVFFAK-TQ2 [TF2-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Lys-TQ2]
13206-AAT 1 mg

TF2-HQKLVFFAK-TQ2 [TF2-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Lys-TQ2]

Sign In for Pricing
View Details
NEK2 (331-445) Mouse Monoclonal Antibody [Clone ID: 2F6]
AM31131PU-N 50 µg

NEK2 (331-445) Mouse Monoclonal Antibody [Clone ID: 2F6]

Sign In for Pricing
View Details
C15orf62 (NM_001130448) Human Over-expression Lysate
LY427214 100 µg

C15orf62 (NM_001130448) Human Over-expression Lysate

Sign In for Pricing
View Details