Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ORC5 Peptide - C-terminal region

ORC5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ORC5, ORC5P, ORC5T

UniProt

O43913

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ORC5 Rabbit Polyclonal Antibody (orb326491) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_859531

Preservative

Lyophilized powder

AA Sequence

TRKLWRNIEPHLKKAMQTVYLREISSSQWEKLQKDDTDPGQLKGIRGSIE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP21A2 (NM_001128590) Human Over-expression Lysate
LY426963 100 µg

CYP21A2 (NM_001128590) Human Over-expression Lysate

Sign In for Pricing
View Details
Human MXRA7 activation kit by CRISPRa
GA118425 1 Kit

Human MXRA7 activation kit by CRISPRa

Sign In for Pricing
View Details
Chchd5 (NM_025395) Mouse Tagged ORF Clone
MG200420 10 µg

Chchd5 (NM_025395) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Tapbp Mouse Gene Knockout Kit (CRISPR)
KN517177 1 Kit

Tapbp Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Bulk Human IgG3 (IB3) Isotype Control
ICH2256-50mg 50 mg

Bulk Human IgG3 (IB3) Isotype Control

Sign In for Pricing
View Details
Serum Amyloid P / APCS (APCS/3240), CF640R conjugate, 0.1mg/mL
BNC403240-500 1x 500 µL

Serum Amyloid P / APCS (APCS/3240), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details