Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRISP3 Peptide - N-terminal region

CRISP3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Aeg2, CRISP-3, CRS3, MGC126588, SGP28, dJ442L6.3

UniProt

P54108

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CRISP3 Rabbit Polyclonal Antibody (orb585931) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006052

Preservative

Lyophilized powder

AA Sequence

PVLLFLVAGLLPSFPANEDKDPAFTALLTTQTQVQREIVNKHNELRRAVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGIF2LX Human qPCR Primer Pair (NM_138960)
HP217095 200 Reactions

TGIF2LX Human qPCR Primer Pair (NM_138960)

Sign In for Pricing
View Details
mVEGF ELISA
JP27102 96 Determinations

mVEGF ELISA

Sign In for Pricing
View Details
GZMK Protein Lysate
OCOA14281-20UG 20 µg

GZMK Protein Lysate

Sign In for Pricing
View Details
Steap1 (NM_027399) Mouse Tagged ORF Clone
MG205069 10 µg

Steap1 (NM_027399) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Guinea Pig Cytochrome P450 2J2 (CYP2J2) ELISA kit
GTR10414588 96 Well

Guinea Pig Cytochrome P450 2J2 (CYP2J2) ELISA kit

Sign In for Pricing
View Details
FAM71B Antibody Blocking peptide
orb1458927 500 µg

FAM71B Antibody Blocking peptide

Sign In for Pricing
View Details