Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRISP3 Peptide - N-terminal region

CRISP3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Aeg2, CRISP-3, CRS3, MGC126588, SGP28, dJ442L6.3

UniProt

P54108

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CRISP3 Rabbit Polyclonal Antibody (orb585931) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006052

Preservative

Lyophilized powder

AA Sequence

PVLLFLVAGLLPSFPANEDKDPAFTALLTTQTQVQREIVNKHNELRRAVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histone H1x (H1FX) Human shRNA Plasmid Kit (Locus ID 8971)
TL312540 1 Kit

Histone H1x (H1FX) Human shRNA Plasmid Kit (Locus ID 8971)

Sign In for Pricing
View Details
Dysbindin (DTNBP1) Human qPCR Template Standard (NM_032122)
HK202631 1 Kit

Dysbindin (DTNBP1) Human qPCR Template Standard (NM_032122)

Sign In for Pricing
View Details
Mnt (F-11) Alexa Fluor® 680
sc-376708 AF680 200 µg/mL

Mnt (F-11) Alexa Fluor® 680

Sign In for Pricing
View Details
Lentiviral mouse Reg3d shRNA (UAS) - Lentiviral mouseReg3d shRNA (UAS, GFP) (25)
GTR15298391 1 Vial

Lentiviral mouse Reg3d shRNA (UAS) - Lentiviral mouseReg3d shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
GNAI2 Antibody (N-term) Blocking Peptide
MBS9220770-01 0.5 mg

GNAI2 Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details
GNAI2 Antibody (N-term) Blocking Peptide
MBS9220770-02 5x 0.5 mg

GNAI2 Antibody (N-term) Blocking Peptide

Sign In for Pricing
View Details