Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

STAC Peptide - middle region

STAC Peptide - middle region

Product Specifications

Product Name Alternative

FLJ32331, STAC1

UniProt

Q99469

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with STAC Rabbit Polyclonal Antibody (orb585937) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003140

Preservative

Lyophilized powder

AA Sequence

KVDPVYETLRFGTSLAQRTKKGSSGSGSDSPHRTSTSDLVEVPEEANGPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Tmem25 shRNA (UAS) - Lentiviral mouse Tmem25 shRNA (UAS, iRFP) (100)
GTR15194931 1 Vial

Lentiviral mouse Tmem25 shRNA (UAS) - Lentiviral mouse Tmem25 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
SYT8, ID (SYT8, Synaptotagmin-8, Synaptotagmin VIII)
MBS6008537-01 0.2 mL

SYT8, ID (SYT8, Synaptotagmin-8, Synaptotagmin VIII)

Sign In for Pricing
View Details
SYT8, ID (SYT8, Synaptotagmin-8, Synaptotagmin VIII)
MBS6008537-02 5x 0.2 mL

SYT8, ID (SYT8, Synaptotagmin-8, Synaptotagmin VIII)

Sign In for Pricing
View Details
Human Anoctamin 9 (ANO9) ELISA Kit
GTR10341295 96 Well

Human Anoctamin 9 (ANO9) ELISA Kit

Sign In for Pricing
View Details
RHOH polyclonal antibody
orb1718110-01 50 µL

RHOH polyclonal antibody

Sign In for Pricing
View Details
RHOH polyclonal antibody
orb1718110-02 100 µL

RHOH polyclonal antibody

Sign In for Pricing
View Details