STAC Peptide - middle region
STAC Peptide - middle region
Product Specifications
Product Name Alternative
FLJ32331, STAC1
UniProt
Q99469
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with STAC Rabbit Polyclonal Antibody (orb585937) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_003140
Preservative
Lyophilized powder
AA Sequence
KVDPVYETLRFGTSLAQRTKKGSSGSGSDSPHRTSTSDLVEVPEEANGPG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1606439-01 48 Well
Human Keratin, type 2 cytoskeletal 6A, KRT6A ELISA Kit
Sign In for Pricing
View Details MBS1606439-02 96 Well
Human Keratin, type 2 cytoskeletal 6A, KRT6A ELISA Kit
Sign In for Pricing
View Details MBS1606439-03 5x 96 Well
Human Keratin, type 2 cytoskeletal 6A, KRT6A ELISA Kit
Sign In for Pricing
View Details MBS1606439-04 10x 96 Well
Human Keratin, type 2 cytoskeletal 6A, KRT6A ELISA Kit
Sign In for Pricing
View Details 