Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S1PR1 Peptide - C-terminal region

S1PR1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CHEDG1, D1S3362, ECGF1, EDG-1, EDG1, FLJ58121, S1P1

UniProt

P21453

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with S1PR1 Rabbit Polyclonal Antibody (orb331276) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001391

Preservative

Lyophilized powder

AA Sequence

SLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

dcr-1 (Center) Rabbit Polyclonal Antibody
AP11794PU-N 400 µL

dcr-1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Phospho-Creb (S133) Recombinant Rabbit Monoclonal Antibody [JB25-40]
ET7107-93 100 µL

Phospho-Creb (S133) Recombinant Rabbit Monoclonal Antibody [JB25-40]

Sign In for Pricing
View Details
Ataxin 1 (ATXN1) Mouse Monoclonal Antibody [Clone ID: 2F5]
AM06558SU-N 100 µL

Ataxin 1 (ATXN1) Mouse Monoclonal Antibody [Clone ID: 2F5]

Sign In for Pricing
View Details
H6PD (NM_004285) Human Over-expression Lysate
LC401369 20 µg

H6PD (NM_004285) Human Over-expression Lysate

Sign In for Pricing
View Details
FKBPL Human Gene Knockout Kit (CRISPR)
KN402153 1 Kit

FKBPL Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse AMH (Anti-Mullerian Hormone) ELISA Kit
E-EL-M3015-01 24 Tests

Mouse AMH (Anti-Mullerian Hormone) ELISA Kit

Sign In for Pricing
View Details