Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S1PR1 Peptide - C-terminal region

S1PR1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CHEDG1, D1S3362, ECGF1, EDG-1, EDG1, FLJ58121, S1P1

UniProt

P21453

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with S1PR1 Rabbit Polyclonal Antibody (orb331276) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001391

Preservative

Lyophilized powder

AA Sequence

SLVRTRSRRLTFRKNISKASRSSEKSLALLKTVIIVLSVFIACWAPLFIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IRF8 Recombinant Rabbit monoclonal Antibody
HA751335 100 µL

IRF8 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Mouse Ebf3 activation kit by CRISPRa
GA201165 1 Kit

Mouse Ebf3 activation kit by CRISPRa

Sign In for Pricing
View Details
Bcl-X (Apoptosis Marker) (BCL2L1/1762), CF740 conjugate, 0.1mg/mL
BNC741762-100 1x 100 µL

Bcl-X (Apoptosis Marker) (BCL2L1/1762), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P2X2 (P2RX2) Human Gene Knockout Kit (CRISPR)
KN416207 1 Kit

P2X2 (P2RX2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Thymidylate Synthase (5-FU Resistance Marker) (TYMS/1884), CF488A conjugate, 0.1mg/mL
BNC881884-100 1x 100 µL

Thymidylate Synthase (5-FU Resistance Marker) (TYMS/1884), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fcgr2b Rabbit Polyclonal Antibody
TA363327 100 µL

Fcgr2b Rabbit Polyclonal Antibody

Sign In for Pricing
View Details