Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CASQ1 Peptide - middle region

CASQ1 Peptide - middle region

Product Specifications

Product Name Alternative

CASQ, PDIB1

UniProt

P31415

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CASQ1 Rabbit Polyclonal Antibody (orb326494) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001222

Preservative

Lyophilized powder

AA Sequence

IEGERELQAFENIEDEIKLIGYFKSKDSEHYKAFEDAAEEFHPYIPFFAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Hydroxy Omeprazole Sodium Salt
TRC-H948863-2.5MG 2.5 mg

5-Hydroxy Omeprazole Sodium Salt

Sign In for Pricing
View Details
Recombinant Human IL-6RA (C-Fc)
PKSH034017-01 10 µg

Recombinant Human IL-6RA (C-Fc)

Sign In for Pricing
View Details
Recombinant Human IL-6RA (C-Fc)
PKSH034017-02 50 µg

Recombinant Human IL-6RA (C-Fc)

Sign In for Pricing
View Details
Semaphorin 3E (SEMA3E) Human Gene Knockout Kit (CRISPR)
KN416038 1 Kit

Semaphorin 3E (SEMA3E) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Giardia lamblia (BB1.1E5), CF740 conjugate, 0.1mg/mL
BNC740210-100 1x 100 µL

Giardia lamblia (BB1.1E5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TBCE Human Gene Knockout Kit (CRISPR)
KN401927 1 Kit

TBCE Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details