Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CASQ1 Peptide - middle region

CASQ1 Peptide - middle region

Product Specifications

Product Name Alternative

CASQ, PDIB1

UniProt

P31415

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CASQ1 Rabbit Polyclonal Antibody (orb326494) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001222

Preservative

Lyophilized powder

AA Sequence

IEGERELQAFENIEDEIKLIGYFKSKDSEHYKAFEDAAEEFHPYIPFFAT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S Rabbit Polyclonal Antibody
TA381941 100 µL

S Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ASNSD1 Human Gene Knockout Kit (CRISPR)
KN401494 1 Kit

ASNSD1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Sulfaethoxypyridazine
TRC-S699255-1G 1 g

Sulfaethoxypyridazine

Sign In for Pricing
View Details
Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2168), 0.2mg/mL
BNUB2168-100 1x 100 µL

Emerin (Papillary Thyroid Carcinoma and EDMD Marker) (EMD/2168), 0.2mg/mL

Sign In for Pricing
View Details
FOXC2 Polyclonal Antibody
E-AB-12420-01 20 µL

FOXC2 Polyclonal Antibody

Sign In for Pricing
View Details
FOXC2 Polyclonal Antibody
E-AB-12420-02 60 µL

FOXC2 Polyclonal Antibody

Sign In for Pricing
View Details