Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RCN1 Peptide - C-terminal region

RCN1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ37041, PIG20, RCAL, RCN

UniProt

Q15293

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RCN1 Rabbit Polyclonal Antibody (orb326495) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002892

Preservative

Lyophilized powder

AA Sequence

QAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gkt Antibody
orb808341 2 mg

Gkt Antibody

Sign In for Pricing
View Details
Human ETS2 (NM_005239) AAV Particle
RC207377A1V 250 µL

Human ETS2 (NM_005239) AAV Particle

Sign In for Pricing
View Details
Phospho-Adrenergic Receptor beta2  (Ser346)  Antibody
ABF3117 100 µg

Phospho-Adrenergic Receptor beta2 (Ser346) Antibody

Sign In for Pricing
View Details
CHCHD2, ID (C7orf17, Coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial, Aging-associated gene 10 protein, HCV NS2 trans-regulated protein) (FITC)
MBS6285549-01 0.2 mL

CHCHD2, ID (C7orf17, Coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial, Aging-associated gene 10 protein, HCV NS2 trans-regulated protein) (FITC)

Sign In for Pricing
View Details
CHCHD2, ID (C7orf17, Coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial, Aging-associated gene 10 protein, HCV NS2 trans-regulated protein) (FITC)
MBS6285549-02 5x 0.2 mL

CHCHD2, ID (C7orf17, Coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial, Aging-associated gene 10 protein, HCV NS2 trans-regulated protein) (FITC)

Sign In for Pricing
View Details
Alix Antibody [A13D20]
F0219-20ul 20 µL

Alix Antibody [A13D20]

Sign In for Pricing
View Details