Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL10 Peptide - C-terminal region

RPL10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp686J1851, DXS648, DXS648E, FLJ23544, FLJ27072, NOV, QM

UniProt

P27635

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPL10 Rabbit Polyclonal Antibody (orb585950) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006004

Preservative

Lyophilized powder

AA Sequence

SIRTKLQNKEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEFEDMVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TCERG1L shRNA (m) Lentiviral Particles
sc-154135-V 200 µL

TCERG1L shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae 10 kDa chaperonin (groS)
MBS1395011-01 0.02 mg (E-Coli)

Recombinant Haemophilus influenzae 10 kDa chaperonin (groS)

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae 10 kDa chaperonin (groS)
MBS1395011-02 0.1 mg (E-Coli)

Recombinant Haemophilus influenzae 10 kDa chaperonin (groS)

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae 10 kDa chaperonin (groS)
MBS1395011-03 0.02 mg (Yeast)

Recombinant Haemophilus influenzae 10 kDa chaperonin (groS)

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae 10 kDa chaperonin (groS)
MBS1395011-04 0.1 mg (Yeast)

Recombinant Haemophilus influenzae 10 kDa chaperonin (groS)

Sign In for Pricing
View Details
Recombinant Haemophilus influenzae 10 kDa chaperonin (groS)
MBS1395011-05 0.02 mg (Baculovirus)

Recombinant Haemophilus influenzae 10 kDa chaperonin (groS)

Sign In for Pricing
View Details