Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPL10 Peptide - C-terminal region

RPL10 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DKFZp686J1851, DXS648, DXS648E, FLJ23544, FLJ27072, NOV, QM

UniProt

P27635

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPL10 Rabbit Polyclonal Antibody (orb585950) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006004

Preservative

Lyophilized powder

AA Sequence

SIRTKLQNKEHVIEALRRAKFKFPGRQKIHISKKWGFTKFNADEFEDMVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RECS1 CRISPR Activation Plasmid (h)
sc-410672-ACT 20 µg

RECS1 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Chicken Carbonic Anhydrase II (CA2) ELISA Kit
MBS453820-01 48 Tests

Chicken Carbonic Anhydrase II (CA2) ELISA Kit

Sign In for Pricing
View Details
Chicken Carbonic Anhydrase II (CA2) ELISA Kit
MBS453820-02 96 Tests

Chicken Carbonic Anhydrase II (CA2) ELISA Kit

Sign In for Pricing
View Details
Chicken Carbonic Anhydrase II (CA2) ELISA Kit
MBS453820-03 5x 96 Tests

Chicken Carbonic Anhydrase II (CA2) ELISA Kit

Sign In for Pricing
View Details
Chicken Carbonic Anhydrase II (CA2) ELISA Kit
MBS453820-04 10x 96 Tests

Chicken Carbonic Anhydrase II (CA2) ELISA Kit

Sign In for Pricing
View Details
Anti-ASIC1 Antibody
CPA7418-01 30 µL

Anti-ASIC1 Antibody

Sign In for Pricing
View Details