Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSL1 Peptide - middle region

MSL1 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp686J17211, MGC141861, MSL-1, hMSL1

UniProt

Q68DK7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MSL1 Rabbit Polyclonal Antibody (orb585956) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001012241

Preservative

Lyophilized powder

AA Sequence

LRSQETPEKPRSSVDTPPRLSTPQKGPSTHPKEKAFSSEIEDLPYLSTTE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2-chloro-4-iodo-5- (trifluoromethyl) pyrimidine
JH916489 1 Each

2-chloro-4-iodo-5- (trifluoromethyl) pyrimidine

Sign In for Pricing
View Details
PUF60 Antibody (N-term)
MBS9208219-01 0.08 mL

PUF60 Antibody (N-term)

Sign In for Pricing
View Details
PUF60 Antibody (N-term)
MBS9208219-02 0.4 mL

PUF60 Antibody (N-term)

Sign In for Pricing
View Details
PUF60 Antibody (N-term)
MBS9208219-03 5x 0.4 mL

PUF60 Antibody (N-term)

Sign In for Pricing
View Details
Tumor Necrosis Factor Receptor 2 (TNFR2, CD120b) (MaxLight 490) discontinued
T9161-24A-ML490 100 µL

Tumor Necrosis Factor Receptor 2 (TNFR2, CD120b) (MaxLight 490) discontinued

Sign In for Pricing
View Details
NOTCH2, CT (Notch 2, Notch 2 homolog, Notch homolog 2, Notch homolog-2) (MaxLight 750)
MBS6453036-01 0.1 mL

NOTCH2, CT (Notch 2, Notch 2 homolog, Notch homolog 2, Notch homolog-2) (MaxLight 750)

Sign In for Pricing
View Details