Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MSL1 Peptide - middle region

MSL1 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp686J17211, MGC141861, MSL-1, hMSL1

UniProt

Q68DK7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MSL1 Rabbit Polyclonal Antibody (orb585956) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001012241

Preservative

Lyophilized powder

AA Sequence

LRSQETPEKPRSSVDTPPRLSTPQKGPSTHPKEKAFSSEIEDLPYLSTTE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Allium sativum Lectin (ASA) - AP (Alkaline Phosphatase)
B2024874 1 mg

Allium sativum Lectin (ASA) - AP (Alkaline Phosphatase)

Sign In for Pricing
View Details
Acetylaconitine
CS-BS-00017 1 Each

Acetylaconitine

Sign In for Pricing
View Details
RGS8 siRNA (Rat)
CRR1480-01 15 nmol

RGS8 siRNA (Rat)

Sign In for Pricing
View Details
RGS8 siRNA (Rat)
CRR1480-02 30 nmol

RGS8 siRNA (Rat)

Sign In for Pricing
View Details
KIAA0776 Protein Vector (Human) (pPM-C-HA)
PV022463 500 ng

KIAA0776 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Trametinib (MEK inhibitor)
SD5973-5mg 5 mg

Trametinib (MEK inhibitor)

Sign In for Pricing
View Details