Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRB3 Peptide - N-terminal region

CRB3 Peptide - N-terminal region

Product Specifications

UniProt

Q9BUF7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CRB3 Rabbit Polyclonal Antibody (orb578655) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_631900

Preservative

Lyophilized powder

AA Sequence

ANPGLGLLLALGLPFLLARWGRAWGQIQTTSANENSTVLPSSTSSSSDGN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Elk4 shRNA (UAS) - Lentiviral mouse Elk4 shRNA (UAS, RFP) (25)
GTR15295934 1 Vial

Lentiviral mouse Elk4 shRNA (UAS) - Lentiviral mouse Elk4 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Thrap3 Rabbit Polyclonal Antibody (Biotin)
orb459736 100 µL

Thrap3 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Mouse Monoclonal HLA DRB1 Antibody (rHLA-DRB/7198) [DyLight 350]
NBP3-20840UV 0.1 mL

Mouse Monoclonal HLA DRB1 Antibody (rHLA-DRB/7198) [DyLight 350]

Sign In for Pricing
View Details
ARPC3, CT (Actin-related Protein 2/3 Complex Subunit 3, Arp2/3 Complex 21kD Subunit, p21-ARC, ARC21) (PE) discontinued
A3576-02B-PE 200 µL

ARPC3, CT (Actin-related Protein 2/3 Complex Subunit 3, Arp2/3 Complex 21kD Subunit, p21-ARC, ARC21) (PE) discontinued

Sign In for Pricing
View Details
Recombinant Mouse Gap junction beta-1 protein (Gjb1)
MBS952310 Inquire

Recombinant Mouse Gap junction beta-1 protein (Gjb1)

Sign In for Pricing
View Details
ZNF75BP Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV756478 1.0 µg DNA

ZNF75BP Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details