Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRB3 Peptide - N-terminal region

CRB3 Peptide - N-terminal region

Product Specifications

UniProt

Q9BUF7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CRB3 Rabbit Polyclonal Antibody (orb578655) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_631900

Preservative

Lyophilized powder

AA Sequence

ANPGLGLLLALGLPFLLARWGRAWGQIQTTSANENSTVLPSSTSSSSDGN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Treponema pallidum p41 Mosaic
7-07570 100 µg

Recombinant Treponema pallidum p41 Mosaic

Sign In for Pricing
View Details
Cytokeratin 6 Antibody
orb2637800 7 mL

Cytokeratin 6 Antibody

Sign In for Pricing
View Details
OPCD00100-10UG - IFNA Recombinant Protein
OPCD00100-10UG 10 µg

OPCD00100-10UG - IFNA Recombinant Protein

Sign In for Pricing
View Details
Rat 5HTR2B (5-Hydroxytryptamine Receptor 2B) ELISA Kit
MBS8821375-01 48 Well

Rat 5HTR2B (5-Hydroxytryptamine Receptor 2B) ELISA Kit

Sign In for Pricing
View Details
Rat 5HTR2B (5-Hydroxytryptamine Receptor 2B) ELISA Kit
MBS8821375-02 96 Well

Rat 5HTR2B (5-Hydroxytryptamine Receptor 2B) ELISA Kit

Sign In for Pricing
View Details
Rat 5HTR2B (5-Hydroxytryptamine Receptor 2B) ELISA Kit
MBS8821375-03 5x 96 Well

Rat 5HTR2B (5-Hydroxytryptamine Receptor 2B) ELISA Kit

Sign In for Pricing
View Details