Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NTM Peptide - N-terminal region

NTM Peptide - N-terminal region

Product Specifications

Product Name Alternative

HNT, IGLON2, MGC60329, NTRI

UniProt

Q9P121

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NTM Rabbit Polyclonal Antibody (orb579351) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001137530

Preservative

Lyophilized powder

AA Sequence

LSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPKIVE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACE Recombinant Rabbit monoclonal Antibody
HA750429 100 µL

ACE Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Buccutite™ Rapid APC-Cy7 Tandem Antibody Labeling Kit *Microscale Optimized for Labeling 100 ug Antibody Per Reaction*
1321-AAT 2 Labelings

Buccutite™ Rapid APC-Cy7 Tandem Antibody Labeling Kit *Microscale Optimized for Labeling 100 ug Antibody Per Reaction*

Sign In for Pricing
View Details
Factor XII Rabbit polyclonal Antibody
HA500586 100 µL

Factor XII Rabbit polyclonal Antibody

Sign In for Pricing
View Details
Biphenyl-3,3'-dicarboxylic acid
TRC-B535255-1G 1 g

Biphenyl-3,3'-dicarboxylic acid

Sign In for Pricing
View Details
Calcium Bis(formyl Homotaurine)
TRC-C145040-25MG 25 mg

Calcium Bis(formyl Homotaurine)

Sign In for Pricing
View Details
Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (rBCL2/782), CF647 conjugate, 0.1mg/mL
BNC472221-500 1x 500 µL

Bcl-2 (Apoptosis & Follicular Lymphoma Marker) (rBCL2/782), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details