Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POC5 Peptide - C-terminal region

POC5 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ35779, MGC120442, MGC120443, MGC120444, POC5, C5orf37

UniProt

Q8NA72

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with POC5 Rabbit Polyclonal Antibody (orb580633) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001092741

Preservative

Lyophilized powder

AA Sequence

IMGVSPPMSSVVVEKHHPVTVQTIPQATAAKYPRTIHPESSTSASRSLGT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glutamic Pyruvic Transaminase, NT (GPT, Glutamic-pyruvic Transaminase 1, Glutamate Pyruvate Transaminase 1, GPT 1, GPT1, Alanine Aminotransferase 1, AAT1, ALT1, Glutamic-alanine Transaminase 1) (FITC) discontinued
G4010-02-FITC 200 µL

Glutamic Pyruvic Transaminase, NT (GPT, Glutamic-pyruvic Transaminase 1, Glutamate Pyruvate Transaminase 1, GPT 1, GPT1, Alanine Aminotransferase 1, AAT1, ALT1, Glutamic-alanine Transaminase 1) (FITC) discontinued

Sign In for Pricing
View Details
Human VEGF ELISA Kit EZ-Set (DIY Antibody Pairs)
MBS1759872-01 5 Plates

Human VEGF ELISA Kit EZ-Set (DIY Antibody Pairs)

Sign In for Pricing
View Details
Human VEGF ELISA Kit EZ-Set (DIY Antibody Pairs)
MBS1759872-02 5x 5 Plates

Human VEGF ELISA Kit EZ-Set (DIY Antibody Pairs)

Sign In for Pricing
View Details
Phospholipase A2 Activating Peptide
E-PP-1758-01 1 mg

Phospholipase A2 Activating Peptide

Sign In for Pricing
View Details
Phospholipase A2 Activating Peptide
E-PP-1758-02 10 mg

Phospholipase A2 Activating Peptide

Sign In for Pricing
View Details
Phospholipase A2 Activating Peptide
E-PP-1758-03 5 mg

Phospholipase A2 Activating Peptide

Sign In for Pricing
View Details