C15orf48 Peptide - N-terminal region
C15orf48 Peptide - N-terminal region
Product Specifications
Product Name Alternative
FLJ22645, FOAP-11, MGC32925, NMES1
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NMES1 Rabbit Polyclonal Antibody (orb325545) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_115789
Preservative
Lyophilized powder
AA Sequence
VAAGGASSFAVYSLWKTDVILDRKKNPEPWETVDPTVPQKLITINQQWKP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880391-500 1x 500 µL
CD81 / TAPA-1 (1.3.3.22), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880017-500 1x 500 µL
Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC742250-100 1x 100 µL
Squamous Cell Carcinoma Antigen 1 (CPTC-SERPINB3-2), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC742968-100 1x 100 µL
EGFR (Epidermal Growth Factor Receptor) (GFR/2968R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882055-100 1x 100 µL
Carcinoembryonic Antigen (CEA) / CD66 (C66/2055R), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details