Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOTCH2NLA Peptide - C-terminal region

NOTCH2NLA Peptide - C-terminal region

Product Specifications

Product Name Alternative

N2N, NOTCH2NL

UniProt

Q7Z3S9

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NOTCH2NLA Rabbit Polyclonal Antibody (orb326061) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_982283

Preservative

Lyophilized powder

AA Sequence

LYVPCAPSPCVNGGTCRQTGDFTFECNCLPETVRRGTELWERDREVWNGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Breast
CS807698 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
RABL5 (IFT22) Rabbit Polyclonal Antibody
TA366141 100 µL

RABL5 (IFT22) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AVD Rabbit Polyclonal Antibody
TA396971S 25 µL

AVD Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2682R), CF640R conjugate, 0.1mg/mL
BNC402682-100 1x 100 µL

Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2682R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calponin-1 (CNN1/832), Biotin conjugate, 0.1mg/mL
BNCB0832-100 1x 100 µL

Calponin-1 (CNN1/832), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Atp5g1 activation kit by CRISPRa
GA200329 1 Kit

Mouse Atp5g1 activation kit by CRISPRa

Sign In for Pricing
View Details