Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOTCH2NLA Peptide - C-terminal region

NOTCH2NLA Peptide - C-terminal region

Product Specifications

Product Name Alternative

N2N, NOTCH2NL

UniProt

Q7Z3S9

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NOTCH2NLA Rabbit Polyclonal Antibody (orb326061) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_982283

Preservative

Lyophilized powder

AA Sequence

LYVPCAPSPCVNGGTCRQTGDFTFECNCLPETVRRGTELWERDREVWNGK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNASEH2B (NM_001142279) Human Over-expression Lysate
LC428003 20 µg

RNASEH2B (NM_001142279) Human Over-expression Lysate

Sign In for Pricing
View Details
RPL9 (NM_001024921) Human Over-expression Lysate
LY422552 100 µg

RPL9 (NM_001024921) Human Over-expression Lysate

Sign In for Pricing
View Details
Human Sideroflexin 1 (SFXN1) ELISA Kit
RD-SFXN1-Hu-01 96 Tests

Human Sideroflexin 1 (SFXN1) ELISA Kit

Sign In for Pricing
View Details
Human Sideroflexin 1 (SFXN1) ELISA Kit
RD-SFXN1-Hu-02 48 Tests

Human Sideroflexin 1 (SFXN1) ELISA Kit

Sign In for Pricing
View Details
CD104 (UM-A9), CF488A conjugate, 0.1mg/mL
BNC880449-100 1x 100 µL

CD104 (UM-A9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EcoRV, 50 preps
FDRE1262 50 Preparations

EcoRV, 50 preps

Sign In for Pricing
View Details