Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDOR1 Peptide - N-terminal region

NDOR1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC138148, NR1, bA350O14.9

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDOR1 Rabbit Polyclonal Antibody (orb582986) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_001716622

Preservative

Lyophilized powder

AA Sequence

PPQGASLFLVSDQTTGRTPMPSPQLLVLFGSQTGTAQDVSERLGREARRR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Caenorhabditis elegans acbp-3 Polyclonal Antibody
MBS7191383 Inquire

Rabbit anti-Caenorhabditis elegans acbp-3 Polyclonal Antibody

Sign In for Pricing
View Details
Map10 (NM_028908) Mouse Tagged Lenti ORF Clone
MR213500L3 10 µg

Map10 (NM_028908) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Lexithromycin 100mg
A19193-100 100 mg

Lexithromycin 100mg

Sign In for Pricing
View Details
a1Acid Glycoprotein, CT (Alpha-1-acid Glycoprotein 1, AGP 1, Orosomucoid-1, OMD 1, AGP1, ORM1) (FITC)
MBS6461029-01 0.2 mL

a1Acid Glycoprotein, CT (Alpha-1-acid Glycoprotein 1, AGP 1, Orosomucoid-1, OMD 1, AGP1, ORM1) (FITC)

Sign In for Pricing
View Details
a1Acid Glycoprotein, CT (Alpha-1-acid Glycoprotein 1, AGP 1, Orosomucoid-1, OMD 1, AGP1, ORM1) (FITC)
MBS6461029-02 5x 0.2 mL

a1Acid Glycoprotein, CT (Alpha-1-acid Glycoprotein 1, AGP 1, Orosomucoid-1, OMD 1, AGP1, ORM1) (FITC)

Sign In for Pricing
View Details
SLC39A4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV683671 1.0 µg DNA

SLC39A4 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details