Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDOR1 Peptide - N-terminal region

NDOR1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MGC138148, NR1, bA350O14.9

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDOR1 Rabbit Polyclonal Antibody (orb582986) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_001716622

Preservative

Lyophilized powder

AA Sequence

PPQGASLFLVSDQTTGRTPMPSPQLLVLFGSQTGTAQDVSERLGREARRR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IL4R shRNA Plasmid
abx952383-01 150 µg

Human IL4R shRNA Plasmid

Sign In for Pricing
View Details
Human IL4R shRNA Plasmid
abx952383-02 300 µg

Human IL4R shRNA Plasmid

Sign In for Pricing
View Details
P2rx7 Rat siRNA Oligo Duplex (Locus ID 29665)
SR503411 1 Kit

P2rx7 Rat siRNA Oligo Duplex (Locus ID 29665)

Sign In for Pricing
View Details
XPC Rabbit Polyclonal Antibody (HRP)
orb1814527 100 µL

XPC Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
RNASEN CRISPR Knock Out 293T Cell Line (Human)
66965141 1x 10^6 Cells / 1.0 mL

RNASEN CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
M-Cresol extrapure AR, 99%
48620 500 mL

M-Cresol extrapure AR, 99%

Sign In for Pricing
View Details