PNPLA2 Peptide - middle region
PNPLA2 Peptide - middle region
Product Specifications
Product Name Alternative
1110001C14Rik, ATGL, DESNUTRIN, DKFZp667M109, FP17548, PEDF-R, TTS-2.2, TTS2
UniProt
Q96AD5
Field of Research
Metabolism Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PNPLA2 Rabbit Polyclonal Antibody (orb584172) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_065109
Preservative
Lyophilized powder
AA Sequence
RDGLRFLQRNGLLNRPNPLLALPPARPHGPEDKDQAVESAQAEDYSQLPG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
M 012-05 5 µmol ~ 2.3 mg
N⁶- Mono- t. butylcarbamoyladenosine- 3', 5'- cyclic monophosphate, sodium salt (6-MBC-cAMP)
Sign In for Pricing
View Details 
MBS2147387-01 0.1 mL
APC-Linked Monoclonal Antibody to Interleukin 7 Receptor (IL7R)
Sign In for Pricing
View Details MBS2147387-02 0.2 mL
APC-Linked Monoclonal Antibody to Interleukin 7 Receptor (IL7R)
Sign In for Pricing
View Details MBS2147387-03 0.5 mL
APC-Linked Monoclonal Antibody to Interleukin 7 Receptor (IL7R)
Sign In for Pricing
View Details MBS2147387-04 1 mL
APC-Linked Monoclonal Antibody to Interleukin 7 Receptor (IL7R)
Sign In for Pricing
View Details MBS2147387-05 5 mL
APC-Linked Monoclonal Antibody to Interleukin 7 Receptor (IL7R)
Sign In for Pricing
View Details